Remote jobs in

2441 remote jobs in Spain

Remote roles open to Spain-based candidates — companies hire remote, but you must be based in Spain. Updated hourly.

Senior Paid Media SpecialistAug 3, 2026

Welocalize·Spain

paid-mediappcsocial-mediadigital-marketingsearch-advertisingsenior-paid-media-specialist

Senior Product ManagerAug 3, 2026

Contentsquare·Spain, United Kingdom

product-managementproduct-managervoice-of-customer-(voc)ai-product-managementb2b-saas-productsenior-product-management

Senior Sales ManagerAug 3, 2026

GR8 Tech·Armenia, Cyprus, Spain

b2b-salessales-managementbusiness-developmentsportsbook-salesenterprise-salessenior-sales-management

Senior Solutions Engineer - EMEAAug 3, 2026

LeoLabs·Afghanistan, Albania, Algeria +149 more

solutions-engineeringsales-engineeringspace-domain-awarenesstechnical-business-developmentaerospace-engineeringsenior-solutions-engineer

Software Engineer - Core Compute (f/m/d)Aug 3, 2026

Exoscale·Germany, Spain

cloud-infrastructure-engineeringbackend-engineeringsystems-engineeringplatform-engineeringcompute-systems-engineercompute-engineer

Software Engineer III, Product Safety & IntegrityAug 3, 2026

Wikimedia Foundation·Brazil, Canada, Colombia +17 more·USD 92,267 - 144,201 / annual

software-engineerproduct-safetyabuse-detectionsecurity-engineeringbackend-developmentsoftware-safety-engineer

Software Engineer | Propr.xyzAug 3, 2026

SwissBorg·Albania, Andorra, Austria +48 more

backend-engineeringblockchain-developmentfintechtrading-systems-engineeringsoftware-engineersoftware-developer

Solutions Sales Executive - GRC IberiaAug 3, 2026

solution-sales-executivegrc-salesenterprise-saas-salesterritory-salestechnology-salesgrc-solutions-sales

Support Engineer Sr Bilingual ( English and Spanish)Aug 3, 2026

Instaleap·Spain

technical-supportcustomer-supportsupport-engineerit-supportoperations-supportbilingual-spanish-technical-support-engineer

Talent Acquisition and Onboarding DirectorAug 3, 2026

Teach For All·Australia, Bangladesh, Belgium +32 more

recruiting-and-onboardingrecruitmenthuman-resourcesglobal-hr-managementtalent-acquisition-directordirector-of-talent-acquisition

Technical Account ManagerAug 3, 2026

technical-account-managementclient-successsolutions-engineeringecommercetechnical-supporttechnical-account-manager

Technical Product ManagerAug 3, 2026

technical-product-managertechnical-product-managementtech-product-managertechnical-product-ownerproduct-manager

Trabajo de verano para Estudiantes- Profesor/a ParticularAug 3, 2026

Tusclasesparticulares·Spain

summer-jobprivate-tutoracademic-tutoronline-tutortutorprofesor-de-clases-particulares

Técnico/a Camunda 8Aug 3, 2026

CONVOTIS Schweiz AG·Spain

bpm-developercamunda-developerprocess-automationapp-developmentbackend-developmentcamunda-bpm

Fullstack Software Engineer (x/f/m) - Care Expert CopilotJul 31, 2026

Alan·Anywhere in France, Belgium, Spain

Partner Solutions Architect (Pan-EMEA GSI)Jul 30, 2026

Datadog·Germany, Remote; Italy, Remote; Spain +4 more

Senior Customer Reliability EngineerJul 28, 2026

Sysdig·Remote Flexible, Spain

Senior Open Source EngineerJul 28, 2026

Sysdig·Remote Flexible, Spain

Senior Software Engineer - REDAPL Graph EngineJul 28, 2026

Datadog·France, Remote; Germany, Remote; Italy +4 more

Salesforce Developer - Service Cloud, Experience Cloud & AI (100% Remote within Spain)Jul 27, 2026

Docplanner·Barcelona

Senior Product Manager – Marketplace (100% Remote within Spain)Jul 24, 2026

Docplanner·Barcelona

Customer Success - Southern EuropeJul 23, 2026

Elevenlabs·Spain

Director of Accounting & ControllingJul 23, 2026

Typeform·Ireland (Remote); Netherlands (Remote) ; Portugal (Remote) ; Spain (Remote) ; United Kingdom (Remote)

Senior AI/ML Engineer (GenAI, AWS)Jul 20, 2026

Provectus·Remote Spain

Hydrus - Voice Contributor - Spanish (Spain)Jul 17, 2026

Weloglobal·Remote Spain

Senior Product DesignerJul 15, 2026

Moniepoint·London, United Kingdom; Remote, India; Remote +4 more

Account Executive - Spain - Mid-MarketJul 10, 2026

Elevenlabs·Spain

Polish LinguistJul 8, 2026

Weloglobal·Remote Spain

Backend/PHP EngineerJun 26, 2026

Airalo·Remote Spain

Translation Validator | Spanish (Spain)Jun 24, 2026

Weloglobal·Remote Spain

Swedish SEO SpecialistJun 23, 2026

Weloglobal·Remote Spain

Norwegian SEO SpecialistJun 22, 2026

Weloglobal·Remote Spain

Circinus - Audio Contributor Spanish (Spain)Jun 18, 2026

Weloglobal·Remote Spain

Senior Data Scientist (Credit)Jun 18, 2026

Moniepoint·Remote, Spain

Danish SEO SpecialistJun 9, 2026

Weloglobal·Remote Spain

Finnish SEO SpecialistJun 9, 2026

Weloglobal·Remote Spain

AI Engineerrecent

Proton·Geneva, Paris, London +4 more

Forward Deployed Engineersrecent

We are hiring at deepset, makers of Haystack·Remote (EU/UK) + hubs: Berlin, Barcelona, London

Senior Data Engineerrecent

QuoIntelligence·Remote - Spain/Italy

Senior DevOps Engineerrecent

Deep Kernel Labs (DKL)·Remote (Spain)·EUR 45,000 - 65,000 / annual

Value Engineer, Product Engineering Tech Lead, Growth Marketer, Account Director (EU Institutions)recent

Haystack·Berlin, Barcelona, London (Remote-first)

Travel medical insurance

Taking a job that lets you work from Spain is the easy part — local healthcare eligibility is not automatic for a remote worker on a foreign address. SafetyWing is travel medical cover designed for that gap.

Get your global insurance today →

Affiliate link — we earn a commission if you buy, at no extra cost to you. It is not health insurance and not a replacement for a national system.

Flights + hotels

Flying to Spain? Compare dates before you commit to a start date.

Compare flights and hotels →

Email me new jobs in Spain

Daily email, only when there's something new. One click to stop.

New remote Spain jobs, weekly.

One digest on Monday. No spam, unsubscribe anytime.